DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb10

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:266 Identity:75/266 - (28%)
Similarity:133/266 - (50%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MVYMASGGKTFEELRNVLKF-----------SENKTL----------VANNYRSLLSDLKRRETF 90
            |||:.:.|.|.:::..||:|           ||.|..          :.:::::|.:::.:....
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPGNS 65

  Fly    91 IILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASA----IVNSWILNRTRGMIR 151
            .:|..|||||..|.|....::.:..:..|.|:.:|:..   |.||.    .:|||:.::|.|.|.
Mouse    66 YVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNF---VEASGQIRKEINSWVGSQTGGKIP 127

  Fly   152 NIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYID 216
            |::.....::.|...||||:||||.|.:.|....|....|.|:.....||:||::..||...:|:
Mouse   128 NLLPDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSMKQSLQVFHIE 192

  Fly   217 DIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGF--IDY-----HLEKKSVNVKLPKFKIE 274
            ::....::|.|.|..||:.::||.::|||.:|:..:.:  :|.     .::...|.:.|||||:|
Mouse   193 ELQTIGLQLHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKME 257

  Fly   275 SKAQLK 280
            ....||
Mouse   258 ESYDLK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 75/266 (28%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 75/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2692
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.