DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb6d

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001070258.1 Gene:Serpinb6d / 238568 MGIID:2667783 Length:375 Species:Mus musculus


Alignment Length:353 Identity:98/353 - (27%)
Similarity:182/353 - (51%) Gaps:21/353 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YRILAS--QNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKF----SENKTLVANNYRSL 80
            :::|.:  .:..:|:..||.|....::|..:.:...|..::|..|..    |:....:..::..|
Mouse    13 FKLLKALDDDTSKNIFLSPPSIASSLAMTLLGAKENTARQIRQTLSLDKCSSDPCEDIHQDFHLL 77

  Fly    81 LSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRL-DDPVSASAIVNSWILN 144
            |:::.:.:..|||...||::|.|.:.:...|...::|.:||:.:.:.. .|...:...:|:|:..
Mouse    78 LNEVNKTDPGIILKTENRLFVEKTFHIKKSFKDASQKFYKAEIEELDFKGDTEQSRQHINTWVTK 142

  Fly   145 RTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSAS 209
            .|...|::::.|...||:|...|||..||||.|...|..:.|....|.||.|.:.||:||...::
Mouse   143 NTDEKIKDLLSPGSVNSNTRLVLVNDFYFKGYWEKPFNKEDTREMPFRVSKNVVKPVQMMFQKST 207

  Fly   210 LLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV---GFIDY----HLEKKSVNVK 267
            ....||::|..||:.|||..:.|:|.|:||:....||.|::|:   .|:::    .:.::.|.|.
Mouse   208 FKITYIEEISTKILLLPYAGNKLNMIIMLPDEHVELRMLEKKMTYEKFVEWTSLDKMNEEEVEVF 272

  Fly   268 LPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAAT 331
            ||:||:|....:..:...:|:.|.|:.. ||.:|:..:.|..:.|::.|||:::.|||.:.:|||
Mouse   273 LPRFKLEEIYDMNNVLYKMGMTDAFEEGRADFSGISSKQGLFLSKVIYKAFIEVIEKGTKVAAAT 337

  Fly   332 GVLTRRKKSIDNLIQPPMEFIADHPFFY 359
            .::........:      .|.|||||.:
Mouse   338 DIVMMGASPTTH------TFCADHPFIF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 98/353 (28%)
Serpinb6dNP_001070258.1 SERPIN 4..375 CDD:294093 98/353 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.