DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina3j

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001094942.1 Gene:Serpina3j / 238395 MGIID:2182843 Length:420 Species:Mus musculus


Alignment Length:394 Identity:107/394 - (27%)
Similarity:181/394 - (45%) Gaps:46/394 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTL 72
            |...|:.:.|....|:.||.:|..:|.::||:|..|.::.:.:.:.|.|.||:...|||:..:|.
Mouse    45 LTLASINTDFAFSLYKKLALKNPHKNFVFSPLSITIALASLSLGAKGNTLEEILEGLKFNLTETP 109

  Fly    73 VAN---NYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSA 134
            .|:   .:..||..|.:....:.:...|.:.|.|...::.||.:.||..:..:..:.....|..|
Mouse   110 EADIHQGFGHLLQRLSQPGDQVQISTGNSMVVEKHLQILAEFKEKARALYHTEVFTADFQQPREA 174

  Fly   135 SAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEII 199
            ..::|.::.|:|:|||:.:|  .|....||..:.|...|.|:|...|...:|.:..|.......:
Mouse   175 RKLLNDYVSNQTQGMIKELV--SDLEERTSMVMTNFALFNGKWNMTFDPYETFMGTFIEDRRTPV 237

  Fly   200 PVKMMTLSASLLSGYIDDIDAK--IIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYHLE-- 260
            .|.||.:. .|.:.|..|...|  ::||.|..:..:| .|||:.    .|:|:    ::..|:  
Mouse   238 KVSMMKMK-ELRAPYFRDEKMKCTVVELNYKGNGKAM-FILPDQ----GKMKQ----VEASLQPA 292

  Fly   261 -----KKSVNVK------LPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQ 314
                 :||:..:      ||||.|....:|:.|...|||.:||...|||:|:......::.::..
Mouse   293 TLRGWRKSLRPRMIDELYLPKFSISKNYRLENILPELGIKEVFSTQADLSGISGGKDVRVSRMFH 357

  Fly   315 KAFLKIDEKGGEASAATG-----VLTRRKKSIDNLIQPPMEFIADHPF-FYVIH-DNKVIYFQGH 372
            .|.|.:.|.|.||.|.|.     :.|:...::.||         :.|| |.|:| |::.|.|.|.
Mouse   358 SAALDMTETGTEARATTRDKYDFLSTKSNPTVVNL---------NTPFLFCVLHSDSENIDFMGK 413

  Fly   373 IVEP 376
            |..|
Mouse   414 INNP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 103/380 (27%)
Serpina3jNP_001094942.1 serpinA3_A1AC 37..417 CDD:381019 106/392 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.