DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina3f

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001028507.2 Gene:Serpina3f / 238393 MGIID:2182838 Length:445 Species:Mus musculus


Alignment Length:394 Identity:105/394 - (26%)
Similarity:188/394 - (47%) Gaps:44/394 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKT 71
            |.||:| .:.|....|:.|..:|...|:::||.|....::::.:.:...|.:|:...|||:..:|
Mouse    35 LTLASS-NTDFAFSLYKELVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTET 98

  Fly    72 L---VANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVS 133
            .   :...:|.||..|.:....:.:...:.:::.|...::.||.:.||..::|:|.:.....|:.
Mouse    99 PEPDIHQGFRYLLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAFTADFQQPLE 163

  Fly   134 ASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEI 198
            |:.::|.::.|.|:|.|:.::  .|.:..|...|||.|||||:|...|..|.|..::||:..|..
Mouse   164 ATKLINDYVSNHTQGKIKELI--SDLDKRTLMVLVNYIYFKGKWEMPFDPDDTCKSEFYLDENRS 226

  Fly   199 IPVKMMTLSASLLSGYI--DDIDAKIIELPYWNSTLSMRIILPN-----------SVDGLRKLKE 250
            :.|.||.:: :|.:.|.  :::...::||.|..:..:| .|||:           ..:.||..|:
Mouse   227 VKVPMMKIN-NLTTPYFRDEELSCTVVELKYTGNASAM-FILPDQGKMQQVEASLQPETLRNWKD 289

  Fly   251 KVGFIDYHLEKKSVN-VKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQ 314
            .       |:.:.:| :.||||.|.:...|:.|...|||.::|...|||:.:......:..::|.
Mouse   290 S-------LKPRLINELCLPKFSISTDYSLEHILPELGIRELFSTQADLSAITGTKDLRTSQVVH 347

  Fly   315 KAFLKIDEKGGEASAATGVLTRRKKSIDNL-----IQPPMEFIADHPFFYVIHDNK--VIYFQGH 372
            ||.|.:.|.|.||:|.||        ..||     :...|:...|.||..:|.|..  :..|...
Mouse   348 KAVLDVAETGTEAAAGTG--------YQNLQCCQGVIYSMKIYFDRPFLMIISDTNTHIALFMAK 404

  Fly   373 IVEP 376
            :..|
Mouse   405 VSNP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 100/379 (26%)
Serpina3fNP_001028507.2 alpha-1-antitrypsin_like 40..405 CDD:239011 101/384 (26%)
RCL 357..382 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.