DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb9

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_033282.1 Gene:Serpinb9 / 20723 MGIID:106603 Length:374 Species:Mus musculus


Alignment Length:366 Identity:99/366 - (27%)
Similarity:189/366 - (51%) Gaps:20/366 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLLSDLKRR 87
            ::|...|..:|:.|||.|....::||.:.:.|:|..::...|..::.:. :...::.||..|.:.
Mouse    17 KMLCQSNPSKNVCYSPASISSALAMVLLGAKGQTAVQISQALGLNKEEG-IHQGFQLLLRKLNKP 80

  Fly    88 ETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS-AIVNSWILNRTRGMIR 151
            :....|.:|||::.:|...::..|.:.:...:.::.:.:...:....| ..:|:|:..:|.|.|.
Mouse    81 DRKYSLRVANRLFADKTCEVLQTFKESSLHFYDSEMEQLSFAEEAEVSRQHINTWVSKQTEGKIP 145

  Fly   152 NIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYID 216
            .::.....:|:|...|:||:||||:|...|..:.|....|.::.:|..||:||....:....|:.
Mouse   146 ELLSGGSVDSETRLVLINALYFKGKWHQPFNKEYTMDMPFKINKDEKRPVQMMCREDTYNLAYVK 210

  Fly   217 DIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGF--------IDYHLEKKSVNVKLPKFKI 273
            ::.|:::.:||....||:.::||:....|.|::..:.|        .|: ::...|.|.|||||:
Mouse   211 EVQAQVLVMPYEGMELSLVVLLPDEGVDLSKVENNLTFEKLTAWMEADF-MKSTDVEVFLPKFKL 274

  Fly   274 ESKAQLKGIFENLGILDVF-KPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRR 337
            :....::.:|:.||::||| :..|||:|:..|....:.|.|.::.::|:|:|.||:||:.::...
Mouse   275 QEDYDMESLFQRLGVVDVFQEDKADLSGMSPERNLCVSKFVHQSVVEINEEGTEAAAASAIIEFC 339

  Fly   338 KKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            ..|     ..| .|.|||||.:.|..||.  |.|.|....|
Mouse   340 CAS-----SVP-TFCADHPFLFFIRHNKANSILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 98/361 (27%)
Serpinb9NP_033282.1 serpin 1..374 CDD:393296 98/364 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.