DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpine2

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_033281.1 Gene:Serpine2 / 20720 MGIID:101780 Length:397 Species:Mus musculus


Alignment Length:378 Identity:107/378 - (28%)
Similarity:182/378 - (48%) Gaps:41/378 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSEN---KTLVANNYRSLLS 82
            |.:|:.|: ...|::.||.....|:.|:.:.:.|||.::|..|::::.|   |.|...| ::::|
Mouse    39 FNQIIKSR-PHENVVVSPHGIASILGMLQLGADGKTKKQLSTVMRYNVNGVGKVLKKIN-KAIVS 101

  Fly    83 DLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTR 147
            . |.::   |:.:||.:::...:.:...|....:..|:.:.:::...||.|||..:|.|:.|.||
Mouse   102 K-KNKD---IVTVANAVFLRNGFKMEVPFAVRNKDVFQCEVQNVNFQDPASASESINFWVKNETR 162

  Fly   148 GMIRNIVLPKDFNSD-TSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLL 211
            |||.|::.|...:.. |...||||:||||.|...|:.:.|....|.....:...|.|:...:...
Mouse   163 GMIDNLLSPNLIDGALTRLVLVNAVYFKGLWKSRFQPESTKKRTFVAGDGKSYQVPMLAQLSVFR 227

  Fly   212 SGYI---DDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYHLEKKSVN-------- 265
            ||..   :.:....|||||...::||.|.||.      :....:..|..|:..|:::        
Mouse   228 SGSTRTPNGLWYNFIELPYHGESISMLIALPT------ESSTPLSAIIPHITTKTIDSWMNTMVP 286

  Fly   266 ----VKLPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGG 325
                :.||||...::..||...:.|||.::|:|| |:...:.......:..|:|||.:::.|.|.
Mouse   287 KRMQLVLPKFTAVAQTDLKEPLKALGITEMFEPSKANFTKITRSESLHVSHILQKAKIEVSEDGT 351

  Fly   326 EASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNK--VIYFQGHIVEP 376
            :|||||..:...:.|      ||. ||.|.||.:.|..|.  .|.|.|.:.:|
Mouse   352 KASAATTAILIARSS------PPW-FIVDRPFLFSIRHNPTGAILFLGQVNKP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 106/373 (28%)
Serpine2NP_033281.1 serpinE2_GDN 21..395 CDD:381039 106/374 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.