DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina3m

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_033279.2 Gene:Serpina3m / 20717 MGIID:98378 Length:418 Species:Mus musculus


Alignment Length:396 Identity:108/396 - (27%)
Similarity:191/396 - (48%) Gaps:48/396 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTL 72
            |...|:.:.|....|:.:|.:|..:|:::||:|....:::|.:.:.|.|.||:...|||:..:|.
Mouse    45 LTLASINTDFAFSLYKKMALKNPDKNIVFSPLSISAALALVSLGAKGNTLEEILEGLKFNLTETS 109

  Fly    73 VAN---NYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSA 134
            .|:   .:..||..|.:.|....:::.|.:::.|...::.||::..|..::.:|.:.....|..|
Mouse   110 EADIHQGFGHLLQRLSQPEDQDQINIGNAMFIEKDLQILAEFHEKTRALYQTEAFTADFQQPTEA 174

  Fly   135 SAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEII 199
            :.::|.::.|:|:|||:.::  .:.:..|...|||.|||||:|..:|....|..::||:.....:
Mouse   175 TKLINDYVSNQTQGMIKKLI--SELDDRTLMVLVNYIYFKGKWKISFDPQDTFESEFYLDEKRSV 237

  Fly   200 PVKMMTLSASLLSGYID-DIDAKIIELPYWNSTLSMRIILPN-----------SVDGLRK----L 248
            .|.||.:.......:.| ::...::||.| ....|...|||:           ..:.|||    |
Mouse   238 KVPMMKMKFLTTRHFRDEELSCSVLELKY-TGNASALFILPDQGRMQQVEASLQPETLRKWWKSL 301

  Fly   249 K-EKVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKI 312
            | .|:|           .:.||||.|.:...||.|...|||.::|...|||:|:.......:.::
Mouse   302 KTRKIG-----------ELYLPKFSISTDYNLKDILPELGIKEIFSKQADLSGITGTKDLSVSQV 355

  Fly   313 VQKAFLKIDEKGGEASAATGVL----TRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQG 371
            |.||.|.:.|.|.||:||||.:    :||.:::      .::|  :.||..||....|  ..|..
Mouse   356 VHKAVLDVAETGTEAAAATGFIFGFRSRRLQTM------TVQF--NRPFLMVISHTGVQTTLFMA 412

  Fly   372 HIVEPR 377
            .:..|:
Mouse   413 KVTNPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 105/381 (28%)
Serpina3mNP_033279.2 SERPIN 56..417 CDD:214513 104/382 (27%)
RCL 367..392 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.