DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina3g

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:395 Identity:101/395 - (25%)
Similarity:189/395 - (47%) Gaps:46/395 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENK 70
            |.|::::.:..|  ..||.|..:|...|:::||.|....::::.:.:...|.:|:...|||:..:
Mouse    35 LTLVSSNTDFAF--SLYRKLVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTE 97

  Fly    71 TL---VANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPV 132
            |.   :...:|.||..|.:....:.:...:.:::.|...::.||.:.||..::|:|.:.....|:
Mouse    98 TPEPDIHQGFRYLLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAFTADFQQPL 162

  Fly   133 SASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANE 197
            .|:.::|.::.|.|:|.|:.::  ..........|||.|||||:|...|..:.|..::||:....
Mouse   163 KATKLINDYVSNHTQGKIKQLI--SGLKESMLMVLVNYIYFKGKWKNPFDPNDTFKSEFYLDEKR 225

  Fly   198 IIPVKMMTLSASLLSGYI-------DDIDAKIIELPYWNSTLSMRIILPN-----------SVDG 244
            .:.|.||.      :||:       :::...::||.|..:..:| .|||:           ..:.
Mouse   226 SVIVSMMK------TGYLTTPYFRDEELSCTVVELKYTGNASAM-FILPDQGRMQQVEASLQPET 283

  Fly   245 LRKLKEKVGFIDYHLEKKSVN-VKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAK 308
            |||.|..       |:.:.:: ::||||.|.:...|:.|...|||.:||...|||:.:......:
Mouse   284 LRKWKNS-------LKPRMIHELRLPKFSISTDYSLEHILPELGIREVFSTQADLSAITGTKDLR 341

  Fly   309 IDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNK--VIYFQG 371
            :.::|.||.|.:.|||.||:||||:......::.:.    :|...:.||..:|.|.|  :..|..
Mouse   342 VSQVVHKAVLDVAEKGTEAAAATGMAGVGCCAVFDF----LEIFFNRPFLMIISDTKAHIALFMA 402

  Fly   372 HIVEP 376
            .:..|
Mouse   403 KVTNP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 98/379 (26%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 98/382 (26%)
RCL 357..382 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.