DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb6b

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_035584.1 Gene:Serpinb6b / 20708 MGIID:894688 Length:377 Species:Mus musculus


Alignment Length:364 Identity:106/364 - (29%)
Similarity:190/364 - (52%) Gaps:22/364 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKF----SENKTLVANNYRSLLSDLKRRE 88
            :::.||:::||||....::||:|.:.|.|..::...|..    .:....|...::|||::..:..
Mouse    21 EDSSRNVLFSPISVSSALAMVFMGAKGTTASQMAQALSLDKCSGKGGRDVHQGFQSLLTETNKTG 85

  Fly    89 TFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS-AIVNSWILNRTRGMIRN 152
            |..:|..|||::..|.:.::..|....||.::|:.:.:........| ..:|:|:..:|...|..
Mouse    86 TQYVLRTANRLFGEKTFDILASFKDSCRKFYEAEMEELDFKGATEQSRQHINAWVAKKTEDKITE 150

  Fly   153 IVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYIDD 217
            ::.....||:|...|||||||||.|...|..:.|....|.|:.:.:.||:||...::....|:::
Mouse   151 LLSSGSVNSNTPLVLVNAIYFKGNWEKQFNKEDTQEMPFNVTKDVVKPVQMMFQKSTFKMTYVEE 215

  Fly   218 IDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV---GFIDY----HLEKKSVNVKLPKFKIES 275
            |...|:.|||..:.|:|.|:||:....|..:::::   .||::    .:|::.|.|.|||||:|.
Mouse   216 ISTNILLLPYVGNELNMIIMLPDEHIELSMVEKEITYKKFIEWTRLDKMEEEEVEVFLPKFKLEE 280

  Fly   276 KAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRKK 339
            ...:|.:...||:.|.|:.. ||.:|:..:.|..:.|::.|:|::::|:|.||:|||..      
Mouse   281 NYDMKDVLCRLGMTDAFEEGMADFSGIASKEGLFLSKVIHKSFVEVNEEGTEAAAATAA------ 339

  Fly   340 SIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            :|......|. |.|:|||.:.|..::.  |.|.|....|
Mouse   340 NIGFRCMVPY-FCANHPFLFFIQHSRTSGIVFCGRFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 105/359 (29%)
Serpinb6bNP_035584.1 serpin 1..377 CDD:393296 105/362 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.