DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb9c

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006516681.1 Gene:Serpinb9c / 20707 MGIID:894669 Length:403 Species:Mus musculus


Alignment Length:381 Identity:108/381 - (28%)
Similarity:187/381 - (49%) Gaps:36/381 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTL-VANNYRSL 80
            |..:..|:|.:.|..:|:.||||:....::|..:...|.|..::...:..  |..: :..::..:
Mouse    38 FAVNLLRMLCNNNPSKNVCYSPINISSALAMFLLGVKGNTEIQISEAIGL--NTAIDIHQSFLWI 100

  Fly    81 LSDLK---RRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDD-PVSASAIVNSW 141
            |:.||   |:.||   .||||::.......:|.|.:...:.:..:.:.:.... |..|...:|:|
Mouse   101 LNILKKPTRKYTF---RMANRLFAENTCEFLPTFKEPCLQFYHWEMEHLPFTKAPEEARNHINTW 162

  Fly   142 ILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTL 206
            :...|:|.|..::.....:|:|...||||:||||:|.:.|....|....|.::.:|..||:||..
Mouse   163 VCKNTKGKIPELLSSGSVDSETRLVLVNALYFKGRWHHQFDIKSTRKMPFKINKDEERPVQMMFQ 227

  Fly   207 SASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGF--------IDYHLEKKS 263
            .......|::::..:::.|||....||:.::||:....|.|::..:.|        .|| |:...
Mouse   228 EDMFKLAYVNEVQVQVLVLPYKGKELSLVVLLPDDGVELSKVEGNLTFEKLSAWTKPDY-LKTTK 291

  Fly   264 VNVKLPKFKIESKAQLKGIFENLGILDVFK-PSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEA 327
            |.|.|||||:|....::.||::||:.|:|: ..|||:.:..|.|..:.|.:||..::::|:|.||
Mouse   292 VLVFLPKFKLEDYYDMESIFQDLGVGDIFQGGKADLSEMSPERGLCVSKFIQKCVVEVNEEGTEA 356

  Fly   328 SAATGVLTRRKKSIDNLI-----QPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            :|||.         |:.:     .....|.|||||.:.|..||.  |.|.|....|
Mouse   357 TAATA---------DDTVCSAETHDGQTFCADHPFLFFIRHNKTNSILFCGRFSFP 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 107/376 (28%)
Serpinb9cXP_006516681.1 serpin 28..403 CDD:393296 107/379 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.