DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina1c

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_033271.1 Gene:Serpina1c / 20702 MGIID:891969 Length:413 Species:Mus musculus


Alignment Length:387 Identity:109/387 - (28%)
Similarity:191/387 - (49%) Gaps:39/387 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLV 73
            :||:: ..|....||.|..|:...|:.:||:|.....:|:.:.|.|.|..::...|:|:..:|..
Mouse    44 IATNL-GDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSE 107

  Fly    74 ANNYRS---LLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS 135
            |:.::|   ||..|.|.::.:.|...|.::||....||.:|.:.|:..::|:..|:...:...|.
Mouse   108 ADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAK 172

  Fly   136 AIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIP 200
            .::|.::...|:|.|...|  |..:.||...|.|.|.|||:|...|..:.|..|:|:|..:..:.
Mouse   173 KVINDFVEKGTQGKIAEAV--KKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVK 235

  Fly   201 VKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYHLEKKSVN 265
            |.|||||..|...:...:.:.::.:.|..:..:: .:||:  ||      |:..::..|.|:.::
Mouse   236 VPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAV-FLLPD--DG------KMQHLEQTLSKELIS 291

  Fly   266 ------------VKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESG-AKIDKIVQKAF 317
                        :..|:..|..:..||.:...|||..:|...|||:|:..|:. .|:.:.|.||.
Mouse   292 KFLLKRPRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAV 356

  Fly   318 LKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVI---HDNKVIYFQGHIVEP 376
            |.:||.|.||:|||.:|     ::...:.|.:.|  ||||.::|   |....: |.|.:|:|
Mouse   357 LTMDETGTEAAAATVLL-----AVPYSMPPIVRF--DHPFLFIIFEEHTQSPL-FVGKVVDP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 105/374 (28%)
Serpina1cNP_033271.1 SERPIN 53..410 CDD:214513 105/375 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.