DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinf2

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_032904.1 Gene:Serpinf2 / 18816 MGIID:107173 Length:491 Species:Mus musculus


Alignment Length:383 Identity:91/383 - (23%)
Similarity:170/383 - (44%) Gaps:58/383 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKT---LVANNYR 78
            |..|.:.::|..:...||:.||:|..:.:|.:.:.:..:|...|..||..:....   |:::.|:
Mouse    89 FTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMNTGSCLPHLLSHFYQ 153

  Fly    79 SLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSAS-------A 136
            :|...        .:.:|.|||:.|.:.:..:|.:.:.:.|.||        ||..:       |
Mouse   154 NLGPG--------TIRLAARIYLQKGFPIKDDFLEQSERLFGAK--------PVKLTGKQEEDLA 202

  Fly   137 IVNSWILNRTRGMIRNIVLPKDFNSD----TSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANE 197
            .:|.|:...|.|.|      :||.|:    |...|:|||:|.|.|...|....|....|::....
Mouse   203 NINQWVKEATEGKI------EDFLSELPDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERF 261

  Fly   198 IIPVKMM-TLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFID----Y 257
            .:.|.|| .:|..|....::..:.::...|:.|: :|..:::|...:.  .:.|.:..:.    |
Mouse   262 TVSVDMMHAVSYPLRWFLLEQPEIQVAHFPFKNN-MSFVVVMPTYFEW--NVSEVLANLTWDTLY 323

  Fly   258 H--LEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKI 320
            |  |:::...|.|||..::.:..|......||:.::|: ..||.| :.|....:..:..::.:::
Mouse   324 HPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQ-GPDLRG-ISEQNLVVSSVQHQSTMEL 386

  Fly   321 DEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPF-FYVIHDN-KVIYFQGHIVEP 376
            .|.|.||:|||.|...| .|:.:       |..:.|| |:::.|. .|..|.|.:..|
Mouse   387 SEAGVEAAAATSVAMNR-MSLSS-------FTVNRPFLFFIMEDTIGVPLFVGSVRNP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 90/378 (24%)
Serpinf2NP_032904.1 alpha2AP 82..433 CDD:239008 90/378 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.