DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpine1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_032897.2 Gene:Serpine1 / 18787 MGIID:97608 Length:402 Species:Mus musculus


Alignment Length:382 Identity:106/382 - (27%)
Similarity:177/382 - (46%) Gaps:41/382 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DF----YRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSL 80
            ||    ::.:...:..||:::||.....:::|:.|.:.|||..::::.:.|..|:...|:..|.|
Mouse    37 DFGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEKGTAHALRQL 101

  Fly    81 LSDL----KRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSW 141
            ..:|    .:.|    :..|:.|:|.:...||..|.....|.|:...|.:...:...|..|:|.|
Mouse   102 SKELMGPWNKNE----ISTADAIFVQRDLELVQGFMPHFFKLFQTMVKQVDFSEVERARFIINDW 162

  Fly   142 ILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTL 206
            :...|:|||.:::.....:..|...||||:||.|||...|....||...|:.|....:.|.||..
Mouse   163 VERHTKGMISDLLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVPMMAQ 227

  Fly   207 SASLLSGYI-----DDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYHLEKK-SVN 265
            |...  .|.     |.::..::||||...||||.|..|...|  ..|......:|..|.:: ..|
Mouse   228 SNKF--NYTEFTTPDGLEYDVVELPYQGDTLSMFIAAPFEKD--VHLSALTNILDAELIRQWKGN 288

  Fly   266 VK-------LPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDE 322
            :.       ||||.:|::..|:|..|.||:.|:|..: ||...|..:....:.:.:||..::::|
Mouse   289 MTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFSATLADFTSLSDQEQLSVAQALQKVRIEVNE 353

  Fly   323 KGGEASAATG-VLTRRKKSIDNLIQPPMEFIADHPFFYVIHDN--KVIYFQGHIVEP 376
            .|..||::|. |::.|        ..|.|.:.|..|.:|:..|  :.|.|.|.::||
Mouse   354 SGTVASSSTAFVISAR--------MAPTEMVIDRSFLFVVRHNPTETILFMGQVMEP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 104/377 (28%)
Serpine1NP_032897.2 SERPIN 29..402 CDD:294093 104/380 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.