DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and srp-1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_503315.1 Gene:srp-1 / 178585 WormBaseID:WBGene00005642 Length:366 Species:Caenorhabditis elegans


Alignment Length:350 Identity:89/350 - (25%)
Similarity:171/350 - (48%) Gaps:36/350 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IYSPISAEIIMSMVYMASGGKTFEELRNVL-------KFSENKTLVANNYRSLLSDLKRRETFII 92
            ::||:|..:.:::|::.:.|.|..::||.:       :|.|:.:.:.....|.::|:   ||.| 
 Worm    32 VFSPVSILLSLALVHLGAKGHTRHDIRNSVVNGSTDEQFIEHFSFINKLLNSSVNDV---ETLI- 92

  Fly    93 LHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPK 157
               |||::|:.:..:...|....|:.:.|:..:|.......|:.|:|.:|...|:|.|.:::.| 
 Worm    93 ---ANRLFVSPEQAIRKAFTDELREHYNAETATIDFKKSQEAAKIMNQFISESTKGKIPDMIKP- 153

  Fly   158 DFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSA--NEIIPVKMMTLSASLLSGYIDDIDA 220
            |...|..|.|:|||:|:|.|...|  .:...::|.:||  |.::|:...|....    |..|.:.
 Worm   154 DNLKDVDAILINAIFFQGDWRRKF--GEPAESNFSISATENRLVPMLRETRDYF----YNKDDEW 212

  Fly   221 KIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYH-----LEKKSVNVKLPKFKIESKAQLK 280
            ::|.:|:.:.:....|.||.....|.:..:.:....:|     :.::.:.:..||||::.|..||
 Worm   213 QVIGIPFKDKSAWFAIFLPTRRFALAENLKSLNAAKFHNLINNVYQEYIFLTFPKFKMDYKINLK 277

  Fly   281 GIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAAT-GVLTRRKKSIDNL 344
            ......|:.::|...|||:|  :..|.::.....:|.:::|:.|..|:||| ..:.....|.|. 
 Worm   278 TALAKFGLAELFTEQADLSG--IGPGLQLASATHQALIEVDQVGTRAAAATEAKIFFTSASSDE- 339

  Fly   345 IQPPMEFIADHPF-FYVIHDNKVIY 368
               |:....|||| |.:|.||..::
 Worm   340 ---PLHIRVDHPFLFAIIKDNSPLF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 89/349 (26%)
srp-1NP_503315.1 serpinL_nematode 11..365 CDD:381047 89/349 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H76659
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.