DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpind1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001317976.1 Gene:Serpind1 / 15160 MGIID:96051 Length:478 Species:Mus musculus


Alignment Length:375 Identity:96/375 - (25%)
Similarity:184/375 - (49%) Gaps:32/375 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DFYRILASQ-NAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSE--------NKTLVAN 75
            :.||:|..| ....||..:|:.....|.|:.:...|:|.||:.:||.|.:        ..|.:.|
Mouse   115 NLYRVLKDQATTSDNLFIAPVGISTAMGMISLGLRGETHEEVHSVLHFRDFVNASSKYEVTTIHN 179

  Fly    76 NYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNS 140
            .:|.|...|.||.....|...|.:|:.|::.:..:|....|:.:.|:|:.....||...|. .|:
Mouse   180 LFRKLTHRLFRRNFGYTLRSVNGLYIQKQFPIREDFKAAMREFYFAEAQEANFPDPAFISK-ANN 243

  Fly   141 WILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMT 205
            .||..|:|:|:..:  ::.:..|...::|.|||||.|:..|..:.||..:|.::..|::.|.||.
Mouse   244 HILKLTKGLIKEAL--ENIDPATQMLILNCIYFKGTWVNKFPVEMTHNHNFRLNEREVVKVSMMQ 306

  Fly   206 LSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV-GFIDYHLEKKSVN---- 265
            ...:.|:....::|..|::|.|... :||.|::|..:.|::.|:.:: ..:....:|...|    
Mouse   307 TKGNFLAANDQELDCDILQLEYVGG-ISMLIVVPRKLSGMKTLEAQLTPQVVERWQKSMTNRTRE 370

  Fly   266 VKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAA 330
            |.|||||:|....|..:.:::||..:|..:.:::| :.:....||....::.:.::|:|.:|:|.
Mouse   371 VLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSG-ISDQRIAIDLFKHQSTITVNEEGTQAAAV 434

  Fly   331 T--GVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            |  |.:.         :...:.|..|.||.:::::::.  :.|.|.:..|
Mouse   435 TTVGFMP---------LSTQVRFTVDRPFLFLVYEHRTSCLLFMGKVTNP 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 95/370 (26%)
Serpind1NP_001317976.1 HCII 43..476 CDD:239002 96/375 (26%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 54..78
Glycosaminoglycan-binding site. /evidence=ECO:0000250 171..191 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.