DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINA12

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:380 Identity:95/380 - (25%)
Similarity:176/380 - (46%) Gaps:27/380 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELR---NVLKFSEN 69
            |...:::.||  ...:.||..|..||:..||:|.....||:.:.:...|.:|::   |..|..|.
Human    48 LARQNMDLGF--KLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEK 110

  Fly    70 KTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSA 134
            .  :...:..::.:|.::...:.|.:.|.::::::.....:|.:.|:..:.|:.......:...|
Human   111 D--LHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMA 173

  Fly   135 SAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEII 199
            ...:|.:|..:|.|.|.|::  ::.:..|...|.|.|:|:.:|.:.|..:.|...||::..|..:
Human   174 QKQINDFISQKTHGKINNLI--ENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSV 236

  Fly   200 PVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGFIDYH------ 258
            .|.||..|.....||.|.:...|:|:|| ...::...|||:  :|..|..||...:|..      
Human   237 KVPMMFRSGIYQVGYDDKLSCTILEIPY-QKNITAIFILPD--EGKLKHLEKGLQVDTFSRWKTL 298

  Fly   259 LEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEK 323
            |.::.|:|.:|:..:.....||.....:|:..:|:...||..:......|:.:.|.||.||:||:
Human   299 LSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDER 363

  Fly   324 GGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            |.|.:|.||..|..       ::.|:....|.|:..:|:..|:  :.|.|.||.|
Human   364 GTEGAAGTGAQTLP-------METPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 90/366 (25%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 94/378 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.