DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinh1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001104513.1 Gene:Serpinh1 / 12406 MGIID:88283 Length:417 Species:Mus musculus


Alignment Length:381 Identity:93/381 - (24%)
Similarity:165/381 - (43%) Gaps:36/381 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNV-----LKFSENKTLVA 74
            :|.....|:.:|...|..|::.||:.....:.:|.:.....|..:.:.|     |:..|..|.:.
Mouse    47 TGLAFSLYQAMAKDQAVENILLSPLVVASSLGLVSLGGKATTASQAKAVLSAEKLRDEEVHTGLG 111

  Fly    75 NNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVN 139
            ...|||.:...|..|:   .:.:|:|.........:|.:.:::.:..:...|...|..||...:|
Mouse   112 ELLRSLSNSTARNVTW---KLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSIN 173

  Fly   140 SWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMM 204
            .|....|.|.:..:.  ||......|.||||::||..|...|.........|.|:.:..:.|.||
Mouse   174 EWASQTTDGKLPEVT--KDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMM 236

  Fly   205 TLSASLLSGYIDDIDAKI--IELPYWNSTLSMRIILPNSVDGLRKL-----KEKVGFIDYHLEKK 262
            ..:.  |..|.||...|:  :|:|..:...|:.|::|:.|:.|.:|     ||::......::||
Mouse   237 HRTG--LYNYYDDEKEKLQMVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKAWMGKMQKK 299

  Fly   263 SVNVKLPKFKIESKAQLKGIFENLGILD-VFKPSADLNGLVLESGAK---IDKIVQKAFLKIDEK 323
            :|.:.|||..:|....|:.....||:.: :.|..|||:.:   ||.|   :..:......:.|.:
Mouse   300 AVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRM---SGKKDLYLASVFHATAFEWDTE 361

  Fly   324 GGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNK--VIYFQGHIVEPR 377
            |....  ..:..|.:      ::.|..|.|||||.:::.||:  .:.|.|.:|.|:
Mouse   362 GNPFD--QDIYGREE------LRSPKLFYADHPFIFLVRDNQSGSLLFIGRLVRPK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 90/373 (24%)
Serpinh1NP_001104513.1 serpinH1_CBP1 35..416 CDD:381003 93/381 (24%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.