DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpina6

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:382 Identity:91/382 - (23%)
Similarity:178/382 - (46%) Gaps:60/382 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKT--FEELR-NVLKFSEN 69
            |..|:|:..|  :.|:.|.:.|:.:|.:.||:|..:.::|:.:::.|.|  .|.|. |:.|.||.
Mouse    34 LAPTNVDFAF--NLYKRLVALNSDKNTLISPVSISMALAMLSLSTRGSTQYLENLGFNMSKMSEA 96

  Fly    70 KTLVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSA 134
            :  :...::.|.|.|::.:|.:.::|.|.:::.:...|...|....:..::::|.:|...|...|
Mouse    97 E--IHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKA 159

  Fly   135 SAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEII 199
            ...:|:.:.|:|:|.|.::|  .|.:|..:..|:|.|:.||.|...|..:.|...||||:....:
Mouse   160 GEQINNHVKNKTQGKIEHVV--SDLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTV 222

  Fly   200 PVKMMTLSASLLSGYIDD--IDAKIIELPYWNSTLSMRIILP--------------NSVDGLRKL 248
            .|.||..|.::  .|..|  |..:::::.|..:..:. ||||              :::|...||
Mouse   223 KVPMMVQSGNI--SYFRDSAIPCQMVQMNYVGNGTTF-IILPDQGQMDTVVAALNRDTIDRWGKL 284

  Fly   249 KEKVGFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIV 313
                      :..:.:|:.:|||.:.....|:.:..::||.|:|...:|......::...: .::
Mouse   285 ----------MIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDTPLTL-TVL 338

  Fly   314 QKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIAD-------HPFFYVIHD 363
            .||.|::|| |....|||.             .||:...::       .||.::..|
Mouse   339 HKAMLQLDE-GNVLPAATN-------------GPPVHLPSESFTLKYNRPFIFLAFD 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 88/373 (24%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 88/373 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.