DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and SERPINA3

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001076.2 Gene:SERPINA3 / 12 HGNCID:16 Length:423 Species:Homo sapiens


Alignment Length:387 Identity:103/387 - (26%)
Similarity:187/387 - (48%) Gaps:31/387 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTL 72
            |.:.:|:..|  ..|:.|..:...:|:|:||:|....::.:.:.:...|..|:...|||:..:|.
Human    49 LASANVDFAF--SLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETS 111

  Fly    73 VA---NNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSA 134
            .|   .:::.||..|.:....:.|.|.|.::|.::..|:..|.:.|::.:.::|.:....|..:|
Human   112 EAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAA 176

  Fly   135 SAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEII 199
            ..::|.::.|.|||.|.:::  ||.:|.|...|||.|:||.:|...|....||.:.||:|..:.:
Human   177 KKLINDYVKNGTRGKITDLI--KDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWV 239

  Fly   200 PVKMMTLSASLLSGYID-DIDAKIIELPYWNSTLSMRIILPNS-----------VDGLRKLKEKV 252
            .|.||:|....:..:.| ::...::||.| ....|...|||:.           .:.|::.::.:
Human   240 MVPMMSLHHLTIPYFRDEELSCTVVELKY-TGNASALFILPDQDKMEEVEAMLLPETLKRWRDSL 303

  Fly   253 GFIDYHLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAF 317
            .|      ::...:.||||.|.....|..|...|||.:.|...|||:|:.......:.::|.||.
Human   304 EF------REIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHKAV 362

  Fly   318 LKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVI--HDNKVIYFQGHIVEPR 377
            |.:.|:|.||||||.|   :...:..|::.......:.||..:|  .|.:.|:|...:..|:
Human   363 LDVFEEGTEASAATAV---KITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPK 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 100/372 (27%)
SERPINA3NP_001076.2 serpinA3_A1AC 40..421 CDD:381019 102/385 (26%)
RCL 369..394 9/27 (33%)
O-glycosylated at one site 381..389 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.