DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and Serpinb7

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_569088.1 Gene:Serpinb7 / 117092 RGDID:71063 Length:380 Species:Rattus norvegicus


Alignment Length:387 Identity:104/387 - (26%)
Similarity:183/387 - (47%) Gaps:28/387 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLATSVESGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKF------ 66
            |.|.:.|.||  |.:|.:.|.....|:.:|.:|....:|::.:.:.|....::...|.|      
  Rat     4 LAAANAEFGF--DLFREMDSSQGNGNVFFSSLSIFTALSLIRLGARGDCARQIDKALHFISPSRQ 66

  Fly    67 --SENKTL-VANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRL 128
              |.|..| :....:.:|:|:........|.:||.::..|.:.....:.:.|...:.||.:.:..
  Rat    67 GNSSNSQLGLQYQLKRVLADINSSHKDYELSIANGVFAEKVFDFHKSYMECAENLYNAKVERVDF 131

  Fly   129 DDPVSASAI-VNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFY 192
            .:.:..:.. :|.||.|.|.|.|:.::.....:|.....||||:||||:|...|....|....|.
  Rat   132 TNDIQETRFKINKWIENETHGKIKKVLGDSSLSSSAVMVLVNAVYFKGKWKSAFTKSDTLSCHFR 196

  Fly   193 VSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKVGF--- 254
            ..:.....|.||..........|.:...:|:||.| :..:||.|:||.  |.|.:::.|:.|   
  Rat   197 SPSGPGKAVNMMHQERRFNLSTIQEPPMQILELQY-HGGISMYIMLPE--DDLSEIESKLSFQNL 258

  Fly   255 IDY----HLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQ 314
            :|:    .::.:.|||.||:||||...:::...:::|:.|:|..| |||:|:.......:.|::.
  Rat   259 MDWTNSRKMKSQYVNVFLPQFKIEKDYEMRSHLKSVGLEDIFVESRADLSGIASGGRLYVSKLMH 323

  Fly   315 KAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKVIYFQGHIVEP 376
            |:.:::.|:|.||:|||     ....::.|:.....|.||.||.:||..|.:|.|.|.:..|
  Rat   324 KSLIEVSEEGTEATAAT-----ESNIVEKLLPESTVFRADRPFLFVIRKNGIILFTGKVSCP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 99/373 (27%)
Serpinb7NP_569088.1 SERPIN 4..380 CDD:294093 103/385 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.