DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and LOC110439158

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_021329696.1 Gene:LOC110439158 / 110439158 -ID:- Length:412 Species:Danio rerio


Alignment Length:375 Identity:99/375 - (26%)
Similarity:183/375 - (48%) Gaps:35/375 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FYRILASQN-AKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANN-----YRS 79
            :.|::.|.: ..:|:.:||.:..:.:|.:.:.:||.|.::|.:.:.:  |..:.:..     :.|
Zfish    48 YKRLIESPDYQSKNIFFSPFTVSMALSKLTLGAGGDTKQQLLSGIGY--NSAIFSTEEMHQLFHS 110

  Fly    80 LLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSI--RLDDPVSASAIVNSWI 142
            ||.|:..| |.:.:.:...:|.:.::....:|.:..::.:.....::  |:.:.|..   :|.::
Zfish   111 LLEDIGNR-TGVDIDIGTALYASDRFKPHSKFLEDMKEFYHTDGFTVDFRVKETVDQ---INKYV 171

  Fly   143 LNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLS 207
            ..:|.|.|...|  .|...||..||:..|||||:|...|..::|..:.|::.....:||:||...
Zfish   172 EEKTHGKINQAV--DDLEKDTLMFLLTYIYFKGKWDKPFNPEKTCESTFHIDDKTTVPVQMMHQY 234

  Fly   208 ASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKE-KVGFIDYHLEK-------KSV 264
            ..|...|..::..|::.|.| |.:.||.:.:|:...|.:.::: ::.....|:||       :.|
Zfish   235 EYLKVYYDAELSIKVLCLDY-NDSFSMFLAVPDVHMGRKTIEDLEMTISRQHIEKWKRSAFERKV 298

  Fly   265 NVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASA 329
            ::.:||..:::...|..|.:.:|:.|:|...||..| |.|....|.|:|.||.|.|||||..|:|
Zfish   299 DIYVPKLSLKTSYFLNDILKGMGMADMFSDKADFTG-VSEEKIFISKVVHKATLDIDEKGTTAAA 362

  Fly   330 ATGVLTRRKKSIDNLIQPPMEFIA-DHPFFYVIHD--NKVIYFQGHIVEP 376
            .|.|..|:      |...|:..:: |.||...|.|  |..|.|.|.:|.|
Zfish   363 VTTVQFRQ------LSYSPLSTLSFDRPFMIFITDQTNDNILFFGKVVNP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 97/370 (26%)
LOC110439158XP_021329696.1 alpha-1-antitrypsin_like 40..403 CDD:239011 97/370 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.