DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpinb10

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_031760330.1 Gene:serpinb10 / 100497689 XenbaseID:XB-GENE-5769609 Length:374 Species:Xenopus tropicalis


Alignment Length:372 Identity:105/372 - (28%)
Similarity:182/372 - (48%) Gaps:19/372 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLL 81
            |..|..|.::...|.:|:::|.:|..|.::|||:.:.|.|..::...|.|.|.:.:.| .:|.||
 Frog    10 FTIDVLREISKTAAGQNVVFSSMSIMISLAMVYLGAHGNTAADMGKALHFDEVEDVHA-QFRVLL 73

  Fly    82 SDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRL-DDPVSASAIVNSWILNR 145
            .:|.:......|...|:::..|||..:|.|.:.....:.|..:.:.. .:|.:..:.:|:||..:
 Frog    74 KELMKNGNDYTLTTVNKLFGEKKYYFLPTFLKAINAFYGAPLEKVDFSSNPEATRSYINAWIQEK 138

  Fly   146 TRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASL 210
            |:|.|:|::.....:.:|...:.|.:||...|...|....|..|.|.:..||.|.|.||....:.
 Frog   139 TKGKIQNLLPENSISPNTVLMVANTLYFLANWTTQFSEHATSKAPFTLITNEQIKVNMMATMNTF 203

  Fly   211 LSGYIDDIDAKIIELPYWNS-TLSMRIILPNSVDGLRKLKEKVGFIDYHLEKKSVN-------VK 267
            ....|.:....::||||.:: .|||.|:||::...|.|:..::.:.:.....:|.|       |.
 Frog   204 NMKRIKNPGMSVLELPYGDTKDLSMVIMLPDNSTVLTKVDREISYENLSKWTRSENMSSNYLAVY 268

  Fly   268 LPKFKIESKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAAT 331
            ||:|::|....||.:..:||:...|..| |:.:|:..:....:..:..|.|::::|||.||::||
 Frog   269 LPRFRMEKSFSLKKVLSSLGMSSAFSQSRANFSGMGKQKQLYVSDVHHKTFIEVNEKGTEAASAT 333

  Fly   332 GVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            |.:    .||.:|...  ||.||.||.:.|..||.  |...|....|
 Frog   334 GSV----MSIRSLANE--EFKADRPFHFFIRHNKTNCILLYGKFYSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 104/367 (28%)
serpinb10XP_031760330.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.