DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpinh1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002937290.2 Gene:serpinh1 / 100490491 XenbaseID:XB-GENE-1005105 Length:450 Species:Xenopus tropicalis


Alignment Length:383 Identity:94/383 - (24%)
Similarity:166/383 - (43%) Gaps:40/383 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SGFWEDFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVL---KFSENKTLVANN 76
            :|...:.|:.:|......|::.||:.....:.:|.:.....|..:.:.||   |.|:..  :.:.
 Frog    80 AGLAFNLYQTMAKDKNVENILLSPVVVASSLGLVSLGGQASTAAQAKAVLSADKLSDEH--IHSG 142

  Fly    77 YRSLLSDLK----RRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAI 137
            ...||:::.    |..|:.|   .||:|.........:|.:.::|.:..:...|...|..|....
 Frog   143 LAELLNEVSNSTARNVTWKI---GNRLYGPSSISFTDDFVKNSKKHYNYEHSKINFRDKRSTLRS 204

  Fly   138 VNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVK 202
            :|.|....|.|.:..:.  .|......|.:|||::||..|...|.........|.|:.:..:.|.
 Frog   205 INEWASQATDGKLPEVT--SDMERTDGALIVNAMFFKPHWDERFHHQMVDNRGFMVTRSFTVSVP 267

  Fly   203 MMTLSASLLSGYIDD--IDAKIIELPYWNSTLSMRIILPNSVDGLRKL-----KEKVGFIDYHLE 260
            ||..:.  |..|::|  ...:|:|:|..:...||..|:|:.|:.|.::     :|:|......:.
 Frog   268 MMHRTG--LYNYLEDEKNGLQILEMPLAHKLSSMLFIMPHHVEPLERVEKLLTREQVKTWVGKMT 330

  Fly   261 KKSVNVKLPKFKIESKAQLKGIFENLGILD-VFKPSADLNGLVLESGAK---IDKIVQKAFLKID 321
            ||:|.|.|||..:|....|:....:||:.: :.|..|||:.:   ||.|   :..:...|.|:.|
 Frog   331 KKAVAVSLPKVSLEVSHDLQKHLGDLGLTEAIDKTKADLSKI---SGKKDLYLASMFHAAALEWD 392

  Fly   322 EKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEPR 377
            ..|....  :.:.:|.:      ::.|..|..||||.::|.|.|.  |.|.|.:|.|:
 Frog   393 TDGNPFD--SDIYSREE------LRAPKLFYVDHPFVFLIKDEKTDSILFIGRLVRPK 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 91/375 (24%)
serpinh1XP_002937290.2 serpinH1_CBP1 68..449 CDD:381003 94/383 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.