DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpinb11

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_002936466.1 Gene:serpinb11 / 100490487 XenbaseID:XB-GENE-6039640 Length:401 Species:Xenopus tropicalis


Alignment Length:396 Identity:111/396 - (28%)
Similarity:200/396 - (50%) Gaps:47/396 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENK----------TLVA 74
            |.::.|.|....:|:.:||:|....:.::::.|...|..:::.|:::.:.|          |...
 Frog    14 DIFKELNSSCENKNIFFSPMSISAALYLLHLGSREDTATQIQKVVRYPDVKKEGFFRRRCATQQR 78

  Fly    75 NN--------------------YRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAF 119
            :|                    :.:|||.|......:.|.:||.::....:..:.::.:.|:..:
 Frog    79 SNEESPGKDVSECGKVSDAHSKFHALLSKLTEDPKGVELQIANGMFAQMNFPFLQQYLECAQALY 143

  Fly   120 KAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKAD 184
            .||.:::..:...:...| |||:.::|:|.|:::......:..|:..|||||||||.|...|:..
 Frog   144 NAKLQNVDFEKDETRENI-NSWVESKTQGKIKDLFEKNSLDKRTALVLVNAIYFKGIWSNPFQEV 207

  Fly   185 QTHIADFYVSANEIIPVKMMTLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLK 249
            .|..|.||||.:.:..|.||..|.....|.|.:::|:|:||||....|||.|:|.|...||:|::
 Frog   208 HTKDAPFYVSKDVVKSVPMMYQSQKFNLGAIKELNAQILELPYQLGALSMFILLTNEKFGLQKIE 272

  Fly   250 EKVGFIDY------HLEKKSVNVKLPKFKIESKAQLKGIFENLGILDVF-KPSADLNGLVLESGA 307
            :::.: :|      ::|...::|.:|:|::|....|.....|:|::|.| :..|:|:| :.:...
 Frog   273 QQLSW-NYLAKGMSNMENTKLDVYIPRFRLEESLDLGSHLINMGMVDAFSEAKANLSG-ISDVPL 335

  Fly   308 KIDKIVQKAFLKIDEKGGEASAATGVLTRRKKSIDNLIQPPMEFIADHPFFYVIHD--NKVIYFQ 370
            .:.|||.|||::::|:|..|:|||||....|.::     .|..|.|||.|.:.|.|  |..|.|.
 Frog   336 YVSKIVHKAFVEVNEEGTVAAAATGVQIAPKMAV-----IPRVFKADHSFLFFIKDNPNDTILFF 395

  Fly   371 GHIVEP 376
            |....|
 Frog   396 GKYESP 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 110/391 (28%)
serpinb11XP_002936466.1 serpinB 7..398 CDD:381072 110/391 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.