DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpine1

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001108031.1 Gene:serpine1 / 100136840 ZFINID:ZDB-GENE-070912-60 Length:384 Species:Danio rerio


Alignment Length:360 Identity:95/360 - (26%)
Similarity:166/360 - (46%) Gaps:25/360 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ASQNA-KRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLLSDLKRRET 89
            |.|:| .|||..||.....::.|..|.:.|.|.:.|.:.:.:|..:..:....|.|..||...:.
Zfish    36 AVQSAPDRNLALSPYGIASVLGMAQMGAYGATLKLLASKMGYSLQERGMPKLQRLLQRDLASEDG 100

  Fly    90 FIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVNSWILNRTRGMIRNIV 154
               :.:|:.:.|::|..|...|.:...|||::....|....|..|..::|||..:.|.|||... 
Zfish   101 ---VEVASGVMVDRKIILEKVFRRSLSKAFQSVPHQIDFSQPEMARQVINSWTSDHTDGMISEF- 161

  Fly   155 LPKDFNSD-TSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYI--- 215
            ||....|: |....:||::|.|.|...|....|....|:......:.|.|||.:.....|..   
Zfish   162 LPSGVLSELTRLVFLNALHFHGVWKTPFDPRNTREQLFHTVNGSAVSVPMMTTTQKFNYGEFVSK 226

  Fly   216 DDIDAKIIELPYWNSTLSMRIILPNSVD-GLRKLKEKVGFIDYH-----LEKKSVNVKLPKFKIE 274
            |.:|..:||:||...::||.::.|...| .|..|.:::.....|     :.|.|..:.:|:|.::
Zfish   227 DGVDYDVIEMPYEGESISMLLVTPFEKDVPLSALNKELSSSRIHQWRQEMRKISKQLSIPRFSMD 291

  Fly   275 SKAQLKGIFENLGILDVFKPS-ADLNGLVLESGAKIDKIVQKAFLKIDEKGGEASAATGVLTRRK 338
            ::..||.....:|:.|:|..| ||.:.:..|....:.|::|:..|:::|:|.:.|:||..:...:
Zfish   292 TEIDLKSTLSRMGLGDIFSQSRADFSRITTEEPLCVSKVLQRVKLEVNEEGTKGSSATAAVIYSR 356

  Fly   339 KSIDNLIQPPMEFIADHPFFYVIHDNK--VIYFQG 371
            .:::       |...|.|||::|....  .:.|.|
Zfish   357 MAVE-------EITLDRPFFFLIQHKPTGALLFSG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 95/360 (26%)
serpine1NP_001108031.1 SERPIN 26..384 CDD:294093 94/358 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.