DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn28B and serpina10b

DIOPT Version :9

Sequence 1:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:376 Identity:92/376 - (24%)
Similarity:179/376 - (47%) Gaps:43/376 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DFYRILASQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFSENKTLVANNYRSLLSDL 84
            :.||.::|.: .||:::||:|.....|.:.:|:.|.|..|:           |...|..:|....
Zfish    41 NLYRKISSLH-DRNVVFSPLSVSTCFSALLLAAQGSTRTEI-----------LKGLNLEALDGGD 93

  Fly    85 KRR--ETFIILH--------MANRIYVNKKYCLVPEFNQLARKAFKAKAKSIRLDDPVSASAIVN 139
            .||  |.|..||        ....:::::.:.|...|:|..::.|.|:...:....|....:::|
Zfish    94 SRRVPELFQQLHQNISLQMEQGTALFLDQHFHLQTNFSQQIQRFFNAEVLRVDFSKPAVCRSLIN 158

  Fly   140 SWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFKGQWLYNFKADQTHIADFYVSANEIIPVKMM 204
            .::..:|...:..::  :.....|...|:|.|::||.|...|..:.|..:.|||....|:.|.||
Zfish   159 EFVSRKTGRKVLEML--ESVEPLTQMLLLNTIFYKGDWERPFNPNNTEKSRFYVDKYNIVQVPMM 221

  Fly   205 TLSASLLSGYIDDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV------GFIDYHLEKKS 263
            .|..........|:.|:::.||| ....||.|:||::......:::::      |:|. ::.:..
Zfish   222 MLEEKFSVVEDRDLRARVLRLPY-RGGASMLILLPSADADYTAIEDEISAERLHGWIK-NMRRMK 284

  Fly   264 VNVKLPKFKIESKAQLKGIFENLGILDVFKPSADLNGLVLESGAKIDKIVQKAFLKIDEKGGEAS 328
            :.|.||:|:::....:..:...|||..||:.||||.||..::..|:.:::.||.:::.|:|..|:
Zfish   285 MEVHLPRFRMDQSYHMHELLPQLGISSVFQDSADLTGLSRDAHLKVSQVLHKAVIEVYEQGTSAA 349

  Fly   329 AATGV-LTRRKKSIDNLIQPPMEFIADHPFFYVIHDNKV--IYFQGHIVEP 376
            ::|.| :|        ....|..||.:.|||:.::..:.  :.|.|.:::|
Zfish   350 SSTSVGIT--------AYSLPDTFIINRPFFFFLYHEETASLLFMGRVIDP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 91/371 (25%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 91/374 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.