DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp28a and Obp99c

DIOPT Version :9

Sequence 1:NP_523505.1 Gene:Obp28a / 34031 FlyBaseID:FBgn0011283 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_651711.1 Gene:Obp99c / 43494 FlyBaseID:FBgn0039682 Length:151 Species:Drosophila melanogaster


Alignment Length:160 Identity:32/160 - (20%)
Similarity:53/160 - (33%) Gaps:57/160 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILVAIVLLGAALVRAFDEKEALAKLMESAESCMPEVGATDADLQ-EMVKKQPASTYAGKCLRACV 70
            ::||:.|...|                .|:...|:.|.....:: :.:|:.|.|......|:..:
  Fly     5 LIVALALCAVA----------------HADDWTPKTGEEIRKIRVDCLKENPLSNDQISQLKNLI 53

  Fly    71 MKN--------------IGILDANGKLDTEAGH--EKAKQYTGNDPAKLKI----ALEIGDTCAA 115
            ..|              :||.     .|.:..|  ..|||:      |:.:    ||:|..:|. 
  Fly    54 FPNEPDVRQYLTCSAIKLGIF-----CDQQGYHADRLAKQF------KMDLSEEEALQIAQSCV- 106

  Fly   116 ITVPDDHCEAAEAYGTCFRGE----AKKHG 141
                ||:.:........|||.    |.|.|
  Fly   107 ----DDNAQKNPTDVWAFRGHQCMMASKIG 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp28aNP_523505.1 PhBP 35..134 CDD:214783 22/119 (18%)
Obp99cNP_651711.1 PBP_GOBP 17..128 CDD:279703 25/126 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.