DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp28a and Obp44a

DIOPT Version :10

Sequence 1:NP_523505.1 Gene:Obp28a / 34031 FlyBaseID:FBgn0011283 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_610358.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster


Alignment Length:55 Identity:16/55 - (29%)
Similarity:25/55 - (45%) Gaps:10/55 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KEALAKLMESAESCMPEVGATDADLQEMVKKQPASTYAGKCLRACVMKNIGILDA 79
            ||..|.|....|.|        ||..|  :|.||:.:|.:..:..:.||:.::.|
  Fly    94 KEDKAALKADIEKC--------ADKNE--QKSPANEWAFRGFKCFLGKNLPLVQA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp28aNP_523505.1 PBP_GOBP 24..134 CDD:460193 16/55 (29%)
Obp44aNP_610358.1 PhBP 32..132 CDD:214783 13/47 (28%)

Return to query results.
Submit another query.