DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp28a and Obp19d

DIOPT Version :9

Sequence 1:NP_523505.1 Gene:Obp28a / 34031 FlyBaseID:FBgn0011283 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster


Alignment Length:141 Identity:54/141 - (38%)
Similarity:79/141 - (56%) Gaps:5/141 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TPIILVAIVLLGAALVRAFDE--KEALAKLMESAESCMPEVGATDADLQEMVKKQPASTYAGKCL 66
            |.::||.|:.|||...:..:|  ::..|:|   |..|..|.||||.|:::::.......:..|||
  Fly     8 TVLLLVGILCLGATSAKPHEEINRDHAAEL---ANECKAETGATDEDVEQLMSHDLPERHEAKCL 69

  Fly    67 RACVMKNIGILDANGKLDTEAGHEKAKQYTGNDPAKLKIALEIGDTCAAITVPDDHCEAAEAYGT 131
            ||||||.:.|:|.:|||:.|...|..|..:.:|..|.....|:...|.||..|:|||:||.||..
  Fly    70 RACVMKKLQIMDESGKLNKEHAIELVKVMSKHDAEKEDAPAEVVAKCEAIETPEDHCDAAFAYEE 134

  Fly   132 CFRGEAKKHGL 142
            |...:.|:|||
  Fly   135 CIYEQMKEHGL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp28aNP_523505.1 PhBP 35..134 CDD:214783 40/98 (41%)
Obp19dNP_523421.2 PBP_GOBP 23..139 CDD:279703 43/118 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452746
Domainoid 1 1.000 68 1.000 Domainoid score I16733
eggNOG 1 0.900 - - E1_2C51N
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I7460
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27108
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012672
OrthoInspector 1 1.000 - - otm49741
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.