DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp28a and Obp8a

DIOPT Version :10

Sequence 1:NP_523505.1 Gene:Obp28a / 34031 FlyBaseID:FBgn0011283 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster


Alignment Length:56 Identity:13/56 - (23%)
Similarity:23/56 - (41%) Gaps:9/56 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LVRAFDEKEALAKLMESAESCMPEVGATDADLQEMVKKQPASTYAGKCLRA--CVM 71
            :|::|..:..|     :.|..:|.:...:|....  :...|.|....|.||  ||:
  Fly    95 IVQSFGGERRL-----NVEQALPAINGCNAKTSS--RGSGAQTVVDWCFRAFVCVL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp28aNP_523505.1 PBP_GOBP 24..134 CDD:460193 11/50 (22%)
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 13/56 (23%)

Return to query results.
Submit another query.