DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp28a and Obp56c

DIOPT Version :9

Sequence 1:NP_523505.1 Gene:Obp28a / 34031 FlyBaseID:FBgn0011283 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_995902.1 Gene:Obp56c / 170882 FlyBaseID:FBgn0046879 Length:245 Species:Drosophila melanogaster


Alignment Length:141 Identity:29/141 - (20%)
Similarity:51/141 - (36%) Gaps:41/141 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VRAFDEKEALAKLMESAESCMPEVGATDADLQEMVKKQPASTYAGKCLRACVMKNIGILDANGKL 83
            |::..:...|..|..:..|.||.:     ||:.   .:|.     :|..:|:.:.:. ||....|
  Fly   103 VQSIGDVNNLGDLDFNGNSQMPYL-----DLKH---NEPL-----QCFVSCLYETLD-LDRYNVL 153

  Fly    84 DTEAGHEKAKQYTGNDPAKLKIALEI-GDTCAAITVPDDHCEAAEAYGTCF-------------- 133
            ..||...:.:....::.|::|...:: |.|         .||||.....|:              
  Fly   154 LEEAFKNQVQTIIQHEKAEIKECSDLQGKT---------RCEAAYKLHLCYNHLKTLEAEQRIRE 209

  Fly   134 ---RGEAKKHG 141
               |.||:..|
  Fly   210 ILERTEAENEG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp28aNP_523505.1 PhBP 35..134 CDD:214783 22/116 (19%)
Obp56cNP_995902.1 PBP_GOBP <125..195 CDD:279703 18/92 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.