DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6055 and CLEC3B

DIOPT Version :9

Sequence 1:NP_001260199.1 Gene:CG6055 / 34027 FlyBaseID:FBgn0031918 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_016862606.1 Gene:CLEC3B / 7123 HGNCID:11891 Length:209 Species:Homo sapiens


Alignment Length:134 Identity:35/134 - (26%)
Similarity:53/134 - (39%) Gaps:43/134 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 DAVS----LETPQ---END----FVKQRIARGNVRYIWTSGRKCNFAGCDRPDLQPPNENGWFWS 132
            |.:|    |.|||   |||    :::|.:  ||...||..             |......|.:..
Human   104 DCISRGGTLGTPQTGSENDALYEYLRQSV--GNEAEIWLG-------------LNDMAAEGTWVD 153

  Fly   133 GSGAKIGPTSQRNTGDWSSTGGYQQPQPDNREAAQGNDESCLSILNNFYNDGIKWHDVACHHIKP 197
            .:||:|   :.:|   |.:.   ...|||.     |..|:| ::|:...|.  ||.|..|....|
Human   154 MTGARI---AYKN---WETE---ITAQPDG-----GKTENC-AVLSGAANG--KWFDKRCRDQLP 201

  Fly   198 FVCE 201
            ::|:
Human   202 YICQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6055NP_001260199.1 CLECT 50..201 CDD:153057 34/132 (26%)
CLEC3BXP_016862606.1 CLECT_tetranectin_like 78..206 CDD:153066 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.