Sequence 1: | NP_001260199.1 | Gene: | CG6055 / 34027 | FlyBaseID: | FBgn0031918 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001919193.1 | Gene: | si:ch211-63p21.3 / 562103 | ZFINID: | ZDB-GENE-160113-18 | Length: | 368 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 38/205 - (18%) |
---|---|---|---|
Similarity: | 69/205 - (33%) | Gaps: | 86/205 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 VSHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENDFVKQRIARGNVRY--IWTSG 108
Fly 109 RKCNFAGCDRPDLQPPNENGWFWSGSGAKIGPTSQRNTGD------WSSTGGYQQPQPDNREAAQ 167
Fly 168 GNDESCLSILNNFYNDGIKWHDVACHHIKPFVCEDS-------DELLNF---------------- 209
Fly 210 VRSRNPNVRL 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6055 | NP_001260199.1 | CLECT | 50..201 | CDD:153057 | 30/158 (19%) |
si:ch211-63p21.3 | XP_001919193.1 | CLECT_1 | 23..130 | CDD:153072 | 31/161 (19%) |
CLECT | 135..247 | CDD:295302 | 6/36 (17%) | ||
CLECT | 253..365 | CDD:153057 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1038166at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |