DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6055 and si:ch211-63p21.3

DIOPT Version :9

Sequence 1:NP_001260199.1 Gene:CG6055 / 34027 FlyBaseID:FBgn0031918 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_001919193.1 Gene:si:ch211-63p21.3 / 562103 ZFINID:ZDB-GENE-160113-18 Length:368 Species:Danio rerio


Alignment Length:205 Identity:38/205 - (18%)
Similarity:69/205 - (33%) Gaps:86/205 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VSHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETPQENDFVKQRIARGNVRY--IWTSG 108
            |...|.|..|:.       :|.:|:..||.:..|..:::...:.:.:|..:   :|.|  :|.. 
Zfish    21 VQRQYHFINENK-------NWTEAQRYCRENYTDLATVDNMNDMNQLKNSL---DVNYGVVWIG- 74

  Fly   109 RKCNFAGCDRPDLQPPNENGWFWSGSGAKIGPTSQRNTGD------WSSTGGYQQPQPDNREAAQ 167
                        ||..|.:.|.||             :||      |:|...|            
Zfish    75 ------------LQGTNVSNWHWS-------------SGDSVLFLNWASGQPY------------ 102

  Fly   168 GNDESCLSILNNFYNDGIKWHDVACHHIKPFVCEDS-------DELLNF---------------- 209
             :.::|..::|.      ||...||.....|:|.:.       ::.:|:                
Zfish   103 -SSDNCAVMING------KWFVGACTATWTFICYNMSGGLVFVNQTMNWRDAQSYCRQNHIDLVS 160

  Fly   210 VRSRNPNVRL 219
            ||::|.|.:|
Zfish   161 VRNQNENQQL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6055NP_001260199.1 CLECT 50..201 CDD:153057 30/158 (19%)
si:ch211-63p21.3XP_001919193.1 CLECT_1 23..130 CDD:153072 31/161 (19%)
CLECT 135..247 CDD:295302 6/36 (17%)
CLECT 253..365 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.