DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6055 and CG4115

DIOPT Version :9

Sequence 1:NP_001260199.1 Gene:CG6055 / 34027 FlyBaseID:FBgn0031918 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_650179.1 Gene:CG4115 / 41499 FlyBaseID:FBgn0038017 Length:220 Species:Drosophila melanogaster


Alignment Length:199 Identity:118/199 - (59%)
Similarity:144/199 - (72%) Gaps:5/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RLALPDPRSCANRVRHASYRDARGVSHSYFFSWEHAPTRSLEVDWLDARNICRRHCMDAVSLETP 86
            ||..|:|:.||.||.|....|.:|    |||||.....:.:|.|||.|||.|||.|||:|||||.
  Fly    26 RLEPPNPQLCAQRVIHEKTPDGKG----YFFSWRDPQLKGVEEDWLTARNYCRRRCMDSVSLETS 86

  Fly    87 QENDFVKQRIARGNVRYIWTSGRKCNFAGCDRPDLQPPNENGWFWSGSGAKIGPTSQRNTGDWSS 151
            .||:::||.:.|.||:|||||||.|:|.|||||||||.|.|||||:.:..|:.||::||.||||.
  Fly    87 LENEWIKQYVVRENVKYIWTSGRLCDFKGCDRPDLQPTNINGWFWTATLQKLAPTTERNQGDWSP 151

  Fly   152 TGGYQQPQPDNREAAQ-GNDESCLSILNNFYNDGIKWHDVACHHIKPFVCEDSDELLNFVRSRNP 215
            |||...|||||||..| |..|:||::||.|||||:.||||||||.|.||||::|.||.:||..||
  Fly   152 TGGIGLPQPDNREYKQNGAPENCLALLNQFYNDGVNWHDVACHHKKSFVCEENDALLKYVRYTNP 216

  Fly   216 NVRL 219
            |:|:
  Fly   217 NLRI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6055NP_001260199.1 CLECT 50..201 CDD:153057 96/151 (64%)
CG4115NP_650179.1 CLECT 65..202 CDD:153057 90/136 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102740at6656
OrthoFinder 1 1.000 - - FOG0008562
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6484
65.950

Return to query results.
Submit another query.