DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6055 and slf

DIOPT Version :9

Sequence 1:NP_001260199.1 Gene:CG6055 / 34027 FlyBaseID:FBgn0031918 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001260046.1 Gene:slf / 33678 FlyBaseID:FBgn0287234 Length:231 Species:Drosophila melanogaster


Alignment Length:206 Identity:100/206 - (48%)
Similarity:132/206 - (64%) Gaps:13/206 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RRLALPDPRSCANRVRHASYRDARGVSHSYFFSWEHAPT-RSLEVDWLDARNICRRHCMDAVSLE 84
            |.|:||.|..||:|.:..|||...      .|...|.|. .:.:|||||.||:||.:|||.|:||
  Fly    32 RFLSLPVPAKCASRPKEFSYRGKN------MFLTTHVPALANKKVDWLDGRNLCREYCMDLVALE 90

  Fly    85 TPQENDFVKQRIARGNVRYIWTSGRKCNFAGCD-RPDLQPPNENGWFWSGSGAKIGPTSQRNTG- 147
            |.::|:.:.:.|.:.:|.||||:||.|:||||: ||||:|....|||||.:..||..|::...| 
  Fly    91 TQEKNNLIFRVIQQNDVPYIWTAGRICDFAGCENRPDLEPKTVYGWFWSATREKIQATNRIPQGW 155

  Fly   148 ---DWSSTGGYQQPQPDNRE-AAQGNDESCLSILNNFYNDGIKWHDVACHHIKPFVCEDSDELLN 208
               .||.||..::|||||.| ......|.|||:|||.|||||.||||||:|.||.:|||::|||.
  Fly   156 GYNPWSQTGHKKRPQPDNAEYDINQTKEQCLSVLNNVYNDGIAWHDVACYHEKPVICEDNEELLR 220

  Fly   209 FVRSRNPNVRL 219
            :|.:.||.:||
  Fly   221 YVAATNPGIRL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6055NP_001260199.1 CLECT 50..201 CDD:153057 78/157 (50%)
slfNP_001260046.1 CLECT 67..213 CDD:153057 75/145 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102740at6656
OrthoFinder 1 1.000 - - FOG0008562
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6484
65.950

Return to query results.
Submit another query.