Sequence 1: | NP_001260199.1 | Gene: | CG6055 / 34027 | FlyBaseID: | FBgn0031918 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038946544.1 | Gene: | Sell / 29259 | RGDID: | 3655 | Length: | 460 | Species: | Rattus norvegicus |
Alignment Length: | 212 | Identity: | 45/212 - (21%) |
---|---|---|---|
Similarity: | 76/212 - (35%) | Gaps: | 70/212 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 PRSCANRVRHASYRDARGVS----HSYFFSWE--------------------------------- 55
Fly 56 --HAPTRSLEVDWLDARNICRRHCMDAVSLETPQENDFVKQRIARGNVRYIWTSGRKCNFAGCDR 118
Fly 119 PDLQPPNENGWFWSGSGAKIGPTSQRNTGDWSSTGGYQQPQPDNREAAQGNDESCLSILNNFYND 183
Fly 184 GIKWHDVACHHIKPFVC 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6055 | NP_001260199.1 | CLECT | 50..201 | CDD:153057 | 38/186 (20%) |
Sell | XP_038946544.1 | CLECT_selectins_like | 97..215 | CDD:153062 | 36/148 (24%) |
EGF_CA | 218..250 | CDD:238011 | |||
CCP | 255..313 | CDD:153056 | |||
PHA02817 | 275..>384 | CDD:165167 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |