DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6055 and LOC108179228

DIOPT Version :9

Sequence 1:NP_001260199.1 Gene:CG6055 / 34027 FlyBaseID:FBgn0031918 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_017206500.1 Gene:LOC108179228 / 108179228 -ID:- Length:322 Species:Danio rerio


Alignment Length:243 Identity:42/243 - (17%)
Similarity:68/243 - (27%) Gaps:103/243 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VDWLDARNICRRHCMDAVSLETPQENDFVKQRIARGNVRYIWTSGRKCNFAGCDRPDLQPPNENG 128
            :.|.||::.||....|..:::|..:.:.:...:..|....:|..             |:....|.
Zfish    32 MSWSDAQSYCRERFTDLATVDTVDDVNRLINTVDAGYSGSVWIG-------------LKREISNH 83

  Fly   129 WFWSGSGAKIGPTSQRNTGD-------------WSST--------------GGYQQPQ-PDNREA 165
            |.||.....|...|....|:             |.:|              .||:... ..|..|
Zfish    84 WVWSNGEDTIAKYSDWAPGEPASGNDCALFNDIWLTTKCSNLYGALCLDEFNGYRMTLIKMNWTA 148

  Fly   166 AQG---------------NDESCLSILNNF--------YNDGIKWHD------------------ 189
            ||.               .::|.|..|.|:        |.|..||.|                  
Zfish   149 AQSYCRKQFTDLAPIYSKKNKSTLHTLANYLMPLWIGLYRDSWKWSDKWNGSFRYWAAGQPFQSA 213

  Fly   190 ------------------VACHHIKPFVCEDSDELLNFVRSRNPNVRL 219
                              .:|...:||:|...|:   |:|.:...::|
Zfish   214 GSVDCVGMTTTDSGKWAPYSCDLQQPFICYGDDK---FIRKQTVRLKL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6055NP_001260199.1 CLECT 50..201 CDD:153057 37/223 (17%)
LOC108179228XP_017206500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.