Sequence 1: | NP_001260199.1 | Gene: | CG6055 / 34027 | FlyBaseID: | FBgn0031918 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017206500.1 | Gene: | LOC108179228 / 108179228 | -ID: | - | Length: | 322 | Species: | Danio rerio |
Alignment Length: | 243 | Identity: | 42/243 - (17%) |
---|---|---|---|
Similarity: | 68/243 - (27%) | Gaps: | 103/243 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 VDWLDARNICRRHCMDAVSLETPQENDFVKQRIARGNVRYIWTSGRKCNFAGCDRPDLQPPNENG 128
Fly 129 WFWSGSGAKIGPTSQRNTGD-------------WSST--------------GGYQQPQ-PDNREA 165
Fly 166 AQG---------------NDESCLSILNNF--------YNDGIKWHD------------------ 189
Fly 190 ------------------VACHHIKPFVCEDSDELLNFVRSRNPNVRL 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6055 | NP_001260199.1 | CLECT | 50..201 | CDD:153057 | 37/223 (17%) |
LOC108179228 | XP_017206500.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1038166at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |