DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6055 and si:ch211-282j17.7

DIOPT Version :9

Sequence 1:NP_001260199.1 Gene:CG6055 / 34027 FlyBaseID:FBgn0031918 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_017212430.1 Gene:si:ch211-282j17.7 / 100034556 ZFINID:ZDB-GENE-041210-289 Length:366 Species:Danio rerio


Alignment Length:188 Identity:44/188 - (23%)
Similarity:75/188 - (39%) Gaps:57/188 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ASYRDARGVSHSYFFSWEHAPT--------------RSLEVDWLDARNICRRHCMDAVSL----E 84
            ||..:...:.:.::|.|..:.|              .:..::|.||::.||::.:|.||:    |
Zfish   102 ASSNNCTVMRNGHWFDWSCSATCFFICYNTNSGLVFVNQTMNWRDAQSYCRQNHIDLVSVRNQNE 166

  Fly    85 TPQENDFVKQRIARGNVRYIWTSGRKCNFAGCDRPDLQPPNENGWFWSGSGAKIGPTSQRNTGDW 149
            :.|...|:..|.:.|:.  :|        .|..|        :.|.||..       |..:...|
Zfish   167 SQQLEKFINDRNSSGSA--VW--------IGLFR--------DTWQWSDH-------SNSSFRYW 206

  Fly   150 SSTGGYQQPQPDNREAAQGNDESCLSILNNFYNDGIKWHDVACHHIKPFVCEDSDELL 207
            ::.      :|:|    .|.||:|..|..|....   |.|..||:..||||.: |:|:
Zfish   207 NTA------EPNN----YGGDENCSVIETNAQRG---WADNPCHYQFPFVCHE-DKLI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6055NP_001260199.1 CLECT 50..201 CDD:153057 39/168 (23%)
si:ch211-282j17.7XP_017212430.1 CLECT_1 23..130 CDD:153072 5/27 (19%)
CLECT 135..245 CDD:295302 36/147 (24%)
CLECT 251..363 CDD:153057 44/188 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.