DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6055 and si:dkey-28d5.4

DIOPT Version :9

Sequence 1:NP_001260199.1 Gene:CG6055 / 34027 FlyBaseID:FBgn0031918 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_021333774.1 Gene:si:dkey-28d5.4 / 100002277 ZFINID:ZDB-GENE-060503-72 Length:240 Species:Danio rerio


Alignment Length:160 Identity:31/160 - (19%)
Similarity:53/160 - (33%) Gaps:74/160 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 WLDARNICRRHCMDAVSLETPQEND----FVKQRIARGNVRYI--------WTSGRKCNFAGCDR 118
            |..|::.||::.:|.|:::...||.    |:..|.:.|:..:|        |:.....:|.    
Zfish    19 WRAAQSYCRQNQIDLVTVKNQNENQQLEKFINDRNSSGSEVWIGLFSDPWQWSDQSDSSFR---- 79

  Fly   119 PDLQPPNENGWFWS------GSGAKIGPTSQRNTGDWSSTGGYQQPQPDNREAAQGNDESCLSIL 177
                       :|:      |:.|.|.|:.|...||:.|.                         
Zfish    80 -----------YWADNFKDYGTCAAIQPSKQGKWGDYFSV------------------------- 108

  Fly   178 NNFYNDGIKWHDVACHHIKPFVCEDSDELL 207
               ||.            .||||.: |:|:
Zfish   109 ---YNQ------------LPFVCHE-DKLI 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6055NP_001260199.1 CLECT 50..201 CDD:153057 28/152 (18%)
si:dkey-28d5.4XP_021333774.1 CLECT 10..117 CDD:321932 28/152 (18%)
CLECT 123..235 CDD:153057 31/160 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.