DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and SEC14L5

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens


Alignment Length:331 Identity:71/331 - (21%)
Similarity:138/331 - (41%) Gaps:54/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKA-ECISYDEHKL--PYID--LGSAQIRMEKEQAPEWALKKAQDELREVPGVKEQAIKELREL 60
            :|.| |.:|.|..||  .||:  ||                        .:..::|..:.:||..
Human   212 LGPALEAVSMDGDKLDADYIERCLG------------------------HLTPMQESCLIQLRHW 252

  Fly    61 IQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMKLKY--GAACENIIPSKLRNVFEAN 123
            :|......:| .||:::.|||...::.:.|.:.|:.....:.::  ....:...|..|...|.|.
Human   253 LQETHKGKIP-KDEHILRFLRAHDFHLDKAREMLRQSLSWRKQHQVDLLLQTWQPPALLEEFYAG 316

  Fly   124 ILNLLPQRDQHGRRLLVLEAGK---KWKPSQVPLVDLFRGI-------QLTVLGSMVEPYSQICG 178
            ..:   .:|..||.|.:|..|:   |.....|....|.|.:       |....||..:....|..
Human   317 GWH---YQDIDGRPLYILRLGQMDTKGLMKAVGEEALLRHVLSVNEEGQKRCEGSTRQLGRPISS 378

  Fly   179 SVVIIDMEGLPLSHITQFTPSFAAML--LDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIRE 241
            ...::|:|||.:.|:  :.|...|:|  ::.:::.....|..:.||....:|.:|:.:..|||.|
Human   379 WTCLLDLEGLNMRHL--WRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLISPFINE 441

  Fly   242 KLRKR-IFFHGKDYK---SLISHIEAKALPPKYGGSATWELPHGKVLGEFFECYSKDYELADS-Y 301
            ..|:: :.:.|.:|:   .|:.:::.:.:|...||.:...:|.|.::.:......::.|..|. :
Human   442 NTRRKFLIYSGSNYQGPGGLVDYLDREVIPDFLGGESVCNVPEGGLVPKSLYMTEEEQEHTDQLW 506

  Fly   302 GYTEGY 307
            .::|.|
Human   507 QWSETY 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/44 (27%)
SEC14 116..272 CDD:238099 39/171 (23%)
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214 0/1 (0%)
CRAL_TRIO_N 243..288 CDD:215024 12/45 (27%)
SEC14 306..479 CDD:214706 42/177 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.