DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and SFH5

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:301 Identity:56/301 - (18%)
Similarity:105/301 - (34%) Gaps:94/301 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KKAQDELRE-VPGVKEQAIKELRELI------------QNEKYLNLPLDDEYMMMFLRPTHYYPE 88
            |:..|:|:: :||:.::......||.            :.:||.:..:.|.......:...:...
Yeast     9 KQVFDKLKKAIPGIIKEKCAGYDELYGYKLNPEGLTQEEVDKYYDEKIADRLTYKLCKAYQFEYS 73

  Fly    89 SALKRLKNFYHMKLKY---GAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKK---W 147
            :.::.|.:..:.:.::   ..|.:.:..::|:||   .||..    |.:|      :|.||   |
Yeast    74 TIVQNLIDILNWRREFNPLSCAYKEVHNTELQNV---GILTF----DANG------DANKKAVTW 125

  Fly   148 K--PSQVPLVDLFRGIQLTV---LGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDY 207
            .  ...|...:||:.:...|   :|.|               .:||.|...|....::...:.||
Yeast   126 NLYGQLVKKKELFQNVDKFVRYRIGLM---------------EKGLSLLDFTSSDNNYMTQVHDY 175

  Fly   208 -----------IQEC------ICMR-----LKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIF-- 248
                       |:.|      |..:     |.|.:.||...:|..::.:.|.|:.|..||:..  
Yeast   176 KGVSVWRMDSDIKNCSKTVIGIFQKYYPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRKKFVVL 240

  Fly   249 -----------------FHGKDYK-SLISHIEAKALPPKYG 271
                             :.|||.| :|.........|.:||
Yeast   241 TDGSKLGQYLKDCPYEGYGGKDKKNNLTKQNVTNVHPTEYG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 6/56 (11%)
SEC14 116..272 CDD:238099 44/206 (21%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 38/189 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.