DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and AT1G19650

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_564092.1 Gene:AT1G19650 / 838552 AraportID:AT1G19650 Length:608 Species:Arabidopsis thaliana


Alignment Length:324 Identity:72/324 - (22%)
Similarity:117/324 - (36%) Gaps:82/324 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMM-FLRPTHYYPESALKRLKNFYHMKLKY 104
            :|||.|        .|.|:.:.::..|...|||.::|: ||....:....|.....|....:..:
plant    77 EELRYV--------SEFRQSLISDHLLPPNLDDYHIMLRFLFARKFDLGKAKLMWTNMIQWRRDF 133

  Fly   105 GAACENIIPSKLRNVFE----ANILNLLPQR----DQHGRRLLVLEAGKKWKPSQVPLVDLFRGI 161
            |.  :.|:..     ||    ..:|...||.    |:.||.:.:...||         ||..:.:
plant   134 GT--DTILED-----FEFPELDEVLRYYPQGYHGVDKEGRPVYIERLGK---------VDASKLM 182

  Fly   162 QLTVL--------------------GSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLD 206
            |:|.|                    ...:.....|..|..|:|::||.|.:.|:........|..
plant   183 QVTTLERYLRYHVKEFEKTITVKFPACCIAAKRHIDSSTTILDVQGLGLKNFTKTARDLIIQLQK 247

  Fly   207 YIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKS-LISHIEAKALPPKY 270
            ...:.....|..:.|:|....|.:|:...|.|:..|...:|...|..|:: |:..|:|..||..:
plant   248 IDSDNYPETLHRMFIINAGSGFKLLWGTVKSFLDPKTVSKIHVLGNKYQNKLLEMIDASQLPDFF 312

  Fly   271 GGSAT--------------WE----LPHGKVLGEFFEC------YSKDYELADSYGYTEGYKMK 310
            ||:.|              |:    |..|:..|.|  |      .|.|.:::.|...|  |.:|
plant   313 GGTCTCADQGGCMRSDKGPWKDSEILKMGRSGGTF--CRHAGAFLSSDSQISSSDKPT--YSLK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 10/45 (22%)
SEC14 116..272 CDD:238099 40/184 (22%)
AT1G19650NP_564092.1 CRAL_TRIO_N 82..126 CDD:215024 11/51 (22%)
SEC14 146..316 CDD:214706 40/178 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.