DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and AT5G63060

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_201111.2 Gene:AT5G63060 / 836426 AraportID:AT5G63060 Length:263 Species:Arabidopsis thaliana


Alignment Length:250 Identity:54/250 - (21%)
Similarity:95/250 - (38%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKKAQDELREVPGVKEQAIKELRELIQNEKYLNLPL-----DDEYMMM-FLRPTHYYPESALKRL 94
            :.::|...:.|..|||:..|:.         .:|||     |||.|:: ||:...:..:.|:.:|
plant    38 VSESQHAHKLVLEVKERLAKDC---------TSLPLGKYGRDDEDMILWFLKDRRFSVDEAIGKL 93

  Fly    95 KNF--YHMKLKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQVP-LVD 156
            ...  :..:.|.....|:.|.: ..:..:|.:...|   |..||.::::...|     .:| |:|
plant    94 TKAIKWRHEFKVDELSEDSIKA-ATDTGKAYVHGFL---DVKGRPVVIVAPAK-----HIPGLLD 149

  Fly   157 LFRGIQLTV------LGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMR 215
            .....:|.|      |..:.....:|.|   |.|:.|....:...   .|...|.|........|
plant   150 PIEDEKLCVFLLEKALSKLPAGQHKILG---IFDLRGFGSQNADL---KFLTFLFDVFYYYYPSR 208

  Fly   216 LKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKY 270
            |..|..|:..:||..::...||.:            |.|.||:....|:.:..:|
plant   209 LDEVLFVDAPFIFQPIWQFTKPLV------------KQYASLVKFCSAETVRKEY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 13/50 (26%)
SEC14 116..272 CDD:238099 33/161 (20%)
AT5G63060NP_201111.2 SEC14 118..261 CDD:214706 33/159 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.