DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and AT5G47510

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001331127.1 Gene:AT5G47510 / 834801 AraportID:AT5G47510 Length:377 Species:Arabidopsis thaliana


Alignment Length:276 Identity:53/276 - (19%)
Similarity:101/276 - (36%) Gaps:62/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KEQAIKELRELIQNEKYLNLPL----------DDEYMMMFLRPTHYYPESALKRLKNFYHMKLKY 104
            ||:......|::  |.:.||.|          |...:..||:...:..|.:.:...|:...::.|
plant    18 KEEQSPNNEEMV--EAFRNLLLLHGHLPDKHGDHNTLRRFLKMRDFDLEKSKEAFLNYMKWRVDY 80

  Fly   105 GAACENIIPSKLRNVFEANILNLLP----QRDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTV 165
            ..   ::|..|.:......:....|    :.|:.||.:.:...|         :.||...::.|.
plant    81 KV---DLISQKFKFEEYGEVKKHYPHGFHKVDKTGRPIYIERLG---------MTDLNAFLKATT 133

  Fly   166 LGSMVEPY--------------------SQICGSVVIIDMEGLPLSHITQFTPSFAAML------ 204
            :...|..:                    ..:..:..|:|:.|:.:|:.::  |:.:..:      
plant   134 IERYVNYHIKEQEKTMSLRYPACSIASDKHVSSTTTILDVSGVGMSNFSK--PARSLFMEIQKID 196

  Fly   205 LDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDY-KSLISHIEAKALPP 268
            .:|..|    .|..:.:||.|..|.||:...|.|:..:...::...|.:| ..|:..||...||.
plant   197 SNYYPE----TLHRLFVVNASSGFRMLWLALKTFLDARTLAKVQVLGPNYLGELLEAIEPSNLPT 257

  Fly   269 KYGGSATWELPHGKVL 284
            ..||:.|.. .||..|
plant   258 FLGGNCTCS-DHGGCL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 10/54 (19%)
SEC14 116..272 CDD:238099 32/186 (17%)
AT5G47510NP_001331127.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.