DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and SEC14

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_195629.2 Gene:SEC14 / 830073 AraportID:AT4G39180 Length:554 Species:Arabidopsis thaliana


Alignment Length:262 Identity:61/262 - (23%)
Similarity:109/262 - (41%) Gaps:48/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMM-FLRPTHYYPESALKRLKNFYHMKLKYGAAC 108
            |:...:.||:...|:.:..::.|....||.:||: |||...:..|.|.:...:..:.:.:|||  
plant    65 EIDTEELQAVDAFRQALILDELLPSKHDDHHMMLRFLRARKFDLEKAKQMWSDMLNWRKEYGA-- 127

  Fly   109 ENIIPS-KLRNVFEANILNLLPQR----DQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGS 168
            :.|:.. ..:.:.|  ::...||.    |:.||.:.:...|:         ||..:.:::|.:..
plant   128 DTIMEDFDFKEIEE--VVKYYPQGYHGVDKEGRPIYIERLGQ---------VDATKLMKVTTIDR 181

  Fly   169 MVE--------------PYSQICG------SVVIIDMEGLPLSHITQFTPSFAAMLLDYIQEC-- 211
            .|:              |...|..      |..|:|::|:.||:..:    .|..||..||:.  
plant   182 YVKYHVKEFEKTFNVKFPACSIAAKRHIDQSTTILDVQGVGLSNFNK----AAKDLLQSIQKIDN 242

  Fly   212 --ICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKS-LISHIEAKALPPKYGGS 273
              ....|..:.|:|....|.:|:...|.|:..|...:|...|..|:: |:..|:|..||...||.
plant   243 DNYPETLNRMFIINAGCGFRLLWNTVKSFLDPKTTAKIHVLGNKYQTKLLEIIDANELPEFLGGK 307

  Fly   274 AT 275
            .|
plant   308 CT 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 13/45 (29%)
SEC14 116..272 CDD:238099 40/184 (22%)
SEC14NP_195629.2 CRAL_TRIO_N 72..115 CDD:215024 13/42 (31%)
SEC14 138..308 CDD:214706 42/184 (23%)
Prefoldin 491..>529 CDD:298833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.