DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and AT4G39170

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_568054.1 Gene:AT4G39170 / 830072 AraportID:AT4G39170 Length:614 Species:Arabidopsis thaliana


Alignment Length:316 Identity:74/316 - (23%)
Similarity:123/316 - (38%) Gaps:62/316 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LREVPGVKE-QAIKELRELIQNEKYLNLPLDDEYMMM-FLRPTHYYPESALKRLKNFYHMKLKYG 105
            :.:|..|:| ||:.|.|:.:..|:.|....||.:||: ||:...:..|.|.....:....:.::|
plant    74 IEDVRDVEELQAVDEFRQALVMEELLPHKHDDYHMMLRFLKARKFDIEKAKHMWADMIQWRKEFG 138

  Fly   106 AACENIIPS-KLRNVFEANILNLLPQR----DQHGRRLLVLEAGK--KWKPSQVPLVDLF----- 158
            .  :.||.. :...:.|  :|...|..    |:.||.:.:...||  ..|..||..:|.:     
plant   139 T--DTIIQDFQFEEIDE--VLKYYPHGYHSVDKEGRPVYIERLGKVDPNKLMQVTTLDRYIRYHV 199

  Fly   159 ----RGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKAV 219
                |...|......:.....|..|..|:|::|:.|.:.|:........|.....:.....|..:
plant   200 KEFERSFMLKFPACTIAAKKYIDSSTTILDVQGVGLKNFTKSARELITRLQKIDGDNYPETLHQM 264

  Fly   220 HIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKS-LISHIEAKALPPKYGGSAT-------- 275
            .|:|....|.:|::..|.|:..|...:|...|..|:| |:..|::..||...||:.|        
plant   265 FIINAGPGFRLLWSTVKSFLDPKTTSKIHVLGCKYQSKLLEIIDSSELPEFLGGACTCADQGGCM 329

  Fly   276 ------WELP-------HG---------KVL---GEFFECYSKDYELADSYGYTEG 306
                  |:.|       ||         |||   |:.. .|:|     .||.:.:|
plant   330 LSDKGPWKNPEIVKMVLHGGAHRAKQVVKVLNSDGKVI-AYAK-----PSYPWIKG 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 15/46 (33%)
SEC14 116..272 CDD:238099 38/171 (22%)
AT4G39170NP_568054.1 CRAL_TRIO_N 84..130 CDD:215024 14/45 (31%)
SEC14 150..318 CDD:214706 38/169 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.