DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and COW1

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001328041.1 Gene:COW1 / 829610 AraportID:AT4G34580 Length:554 Species:Arabidopsis thaliana


Alignment Length:253 Identity:58/253 - (22%)
Similarity:103/253 - (40%) Gaps:40/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QAIKELRELIQNEKYLNLPLDDEYMMM-FLRPTHYYPESALKRLKNFYHMKLKYGAACENIIPS- 114
            ||:...|:.:..::.|...|||.:||: |||...:..|.|.:...:....:..:||  :.||.. 
plant    64 QALDAFRQALILDELLPSKLDDLHMMLRFLRARKFDIEKAKQMWSDMIQWRKDFGA--DTIIEDF 126

  Fly   115 KLRNVFEANILNLLPQR----DQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPY-- 173
            ....:.|  ::...||.    |:.||.:.:...|:         :|..:.:|:|.:...|:.:  
plant   127 DFEEIDE--VMKHYPQGYHGVDKEGRPVYIERLGQ---------IDANKLLQVTTMDRYVKYHVK 180

  Fly   174 ------------------SQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKAVH 220
                              ..|..|..|:|::|:.|.:.::........|.....|.....|..:.
plant   181 EFEKTFKVKFPSCSVAANKHIDQSTTILDVQGVGLKNFSKSARELLQRLCKIDNENYPETLNRMF 245

  Fly   221 IVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKS-LISHIEAKALPPKYGGSATWE 277
            |:|....|.:|::..|.|:..|...:|...|..|.| |:..|:|..||..:||:.|.|
plant   246 IINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYHSKLLEVIDASELPEFFGGACTCE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 14/44 (32%)
SEC14 116..272 CDD:238099 36/180 (20%)
COW1NP_001328041.1 CRAL_TRIO_N 64..107 CDD:215024 14/42 (33%)
SEC14 133..298 CDD:214706 36/175 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.