DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and AT2G18180

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_179410.1 Gene:AT2G18180 / 816331 AraportID:AT2G18180 Length:558 Species:Arabidopsis thaliana


Alignment Length:253 Identity:58/253 - (22%)
Similarity:104/253 - (41%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMM-FLRPTHYYPESALKRLKNFYHMKLKY 104
            :||:.|...::..|  |.||:.::.      ||.:||: ||:...:..|...:...:....:.::
plant    54 EELKVVDAFRQVLI--LDELLPDKH------DDYHMMLRFLKARKFDLEKTNQMWSDMLRWRKEF 110

  Fly   105 GAACENIIPS-KLRNVFEANILNLLPQR----DQHGRRLLVLEAGK--KWKPSQVPLVDLF---- 158
            ||  :.::.. :.:.:.|  :|...||.    |:.||.:.:...|:  ..|..||..:|.:    
plant   111 GA--DTVMEDFEFKEIDE--VLKYYPQGHHGVDKEGRPVYIERLGQVDSTKLMQVTTMDRYVNYH 171

  Fly   159 -----RGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKA 218
                 |...:......:.....|..|..|:|::|:.|.:..:........|.....:.....|..
plant   172 VMEFERTFNVKFPACSIAAKKHIDQSTTILDVQGVGLKNFNKAARDLITRLQKVDGDNYPETLNR 236

  Fly   219 VHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKS-LISHIEAKALPPKYGGSAT 275
            :.|:|....|.||:...|.|:..|...:|...|..|:| |:..|:|..||...|||.|
plant   237 MFIINAGSGFRMLWNTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDASELPEFLGGSCT 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 11/45 (24%)
SEC14 116..272 CDD:238099 38/171 (22%)
AT2G18180NP_179410.1 CRAL_TRIO_N 57..100 CDD:215024 12/50 (24%)
SEC14 123..293 CDD:214706 40/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.