DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and AT2G16380

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001323459.1 Gene:AT2G16380 / 816135 AraportID:AT2G16380 Length:547 Species:Arabidopsis thaliana


Alignment Length:262 Identity:57/262 - (21%)
Similarity:100/262 - (38%) Gaps:48/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMM-FLRPTHYYPESALKRLKNFYHMKLKYGAAC 108
            ::.|....:::..|:::..:..|....||.:||: |||...:..|.|.:...:....::.:|.  
plant    57 DINGDDYLSVEAFRQVLVLDDLLPPKHDDLHMMLRFLRARKFDKEKAKQMWSDMLQWRMDFGV-- 119

  Fly   109 ENIIPSKLRNVFE----ANILNLLPQR----DQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTV 165
            :.||..     ||    ..:|...||.    |:.||.:.:...|:         :|..:.:|.|.
plant   120 DTIIED-----FEFEEIDQVLKHYPQGYHGVDKEGRPVYIERLGQ---------IDANKLLQATT 170

  Fly   166 LGSMVEPY---------------------SQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQ 209
            : ...|.|                     ..|..|..|.|::|:.|.:..:........||....
plant   171 M-DRYEKYHVKEFEKMFKIKFPSCSAAAKKHIDQSTTIFDVQGVGLKNFNKSARELLQRLLKIDN 234

  Fly   210 ECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYK-SLISHIEAKALPPKYGGS 273
            :.....|..:.|:|....|.:|:|..|.|:..|...:|...|..|: .|:..|:|..||..:||.
plant   235 DNYPETLNRMFIINAGPGFRLLWAPIKKFLDPKTTSKIHVLGNKYQPKLLEAIDASELPYFFGGL 299

  Fly   274 AT 275
            .|
plant   300 CT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 11/45 (24%)
SEC14 116..272 CDD:238099 39/185 (21%)
AT2G16380NP_001323459.1 CRAL_TRIO_N 65..107 CDD:215024 11/41 (27%)
SEC14 134..300 CDD:214706 39/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.