DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and Sec14l2

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_653103.1 Gene:Sec14l2 / 67815 MGIID:1915065 Length:403 Species:Mus musculus


Alignment Length:272 Identity:65/272 - (23%)
Similarity:117/272 - (43%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KEQAIKELRELIQNEKYLNLPL----DDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGAACEN 110
            :|:|:.:.||.:|:.    ||.    ||.:::.:||...:..:.:...|:.  |::.:.....:.
Mouse    12 QEEALAKFRENVQDV----LPTLPNPDDYFLLRWLRARSFDLQKSEAMLRK--HVEFRKQKDIDK 70

  Fly   111 IIPSKLRNVFEANI---------------LNLLPQRDQHGRRLLVLEAGK------KWKPSQVPL 154
            ||..:...|.:..:               .:::...|..|   |:..|.|      |.:..::.|
Mouse    71 IISWQPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKG---LLFSASKQDLLRTKMRDCELLL 132

  Fly   155 VDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAM--LLDYIQECICMRLK 217
            .:..:  |.|.||..:|..:      :|.|.|||.|.|:  :.|:..|.  .|...:|.....||
Mouse   133 QECIQ--QTTKLGKKIETIT------MIYDCEGLGLKHL--WKPAVEAYGEFLTMFEENYPETLK 187

  Fly   218 AVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKS-LISHIEAKALPPKYGGSATWELPHG 281
            .:.:|....:|.:.:.:.|||:.|..|::|...|.::|. |:.||....||.:|||:.|  .|.|
Mouse   188 RLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGANWKEVLLKHISPDQLPVEYGGTMT--DPDG 250

  Fly   282 KVLGEFFECYSK 293
            ..     :|.||
Mouse   251 NP-----KCKSK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/48 (25%)
SEC14 116..272 CDD:238099 42/179 (23%)
Sec14l2NP_653103.1 CRAL_TRIO_N 13..59 CDD:215024 12/51 (24%)
SEC14 76..244 CDD:214706 43/180 (24%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.